SCOP 1.75: Domain d1zykc1: 1zyk C:1-70

Lineage for d1zykc1 (1zyk C:1-70)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family)

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81775] (5 PDB entries)

8. Domain d1zykc1: 1zyk C:1-70 [125834]
   Other proteins in same PDB: d1zyka2, d1zykb2, d1zykc2, d1zykd2
   automatically matched to d1gxba1
   complexed with be2, mg, prp

Details for d1zykc1

PDB Entry: 1zyk, 2.4 Å

PDB Description: anthranilate phosphoribosyltransferase in complex with prpp, anthranilate and magnesium

PDB Compounds: (C:) Anthranilate phosphoribosyltransferase

SCOP Domain Sequences for d1zykc1:

Sequence; same for both SEQRES and ATOM records:

>d1zykc1 a.46.2.1 (C:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

Timeline for d1zykc1:

• d1zykc1 first appeared in SCOP 1.73
  
• d1zykc1 appears in SCOPe 2.01
  
• d1zykc1 appears in the current release, SCOPe 2.08