Lineage for d1zykb1 (1zyk B:1-70)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642273Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 642282Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) (S)
  5. 642283Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 642284Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 642285Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81775] (5 PDB entries)
  8. 642295Domain d1zykb1: 1zyk B:1-70 [125832]
    Other proteins in same PDB: d1zyka2, d1zykb2, d1zykc2, d1zykd2
    automatically matched to d1gxba1
    complexed with be2, mg, prp

Details for d1zykb1

PDB Entry: 1zyk (more details), 2.4 Å

PDB Description: anthranilate phosphoribosyltransferase in complex with prpp, anthranilate and magnesium
PDB Compounds: (B:) Anthranilate phosphoribosyltransferase

SCOP Domain Sequences for d1zykb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zykb1 a.46.2.1 (B:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

SCOP Domain Coordinates for d1zykb1:

Click to download the PDB-style file with coordinates for d1zykb1.
(The format of our PDB-style files is described here.)

Timeline for d1zykb1: