Lineage for d1zyej1 (1zye J:6-163)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 699956Protein Peroxiredoxin-3 (AOP-1, SP-22) [142391] (1 species)
  7. 699957Species Cow (Bos taurus) [TaxId:9913] [142392] (1 PDB entry)
  8. 699967Domain d1zyej1: 1zye J:6-163 [125826]
    automatically matched to 1ZYE A:6-163
    mutant

Details for d1zyej1

PDB Entry: 1zye (more details), 3.3 Å

PDB Description: crystal structure analysis of bovine mitochondrial peroxiredoxin iii
PDB Compounds: (J:) Thioredoxin-dependent peroxide reductase

SCOP Domain Sequences for d1zyej1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyej1 c.47.1.10 (J:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]}
qhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasefhdvn
cevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpglalrgl
fiidpngvikhlsvndlpvgrsveetlrlvkafqfvea

SCOP Domain Coordinates for d1zyej1:

Click to download the PDB-style file with coordinates for d1zyej1.
(The format of our PDB-style files is described here.)

Timeline for d1zyej1: