Lineage for d1zyeh1 (1zye H:6-163)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485606Protein Peroxiredoxin-3 (AOP-1, SP-22) [142391] (1 species)
  7. 2485607Species Cow (Bos taurus) [TaxId:9913] [142392] (1 PDB entry)
    Uniprot P35705 63-220
  8. 2485615Domain d1zyeh1: 1zye H:6-163 [125824]
    automatically matched to 1ZYE A:6-163

Details for d1zyeh1

PDB Entry: 1zye (more details), 3.3 Å

PDB Description: crystal structure analysis of bovine mitochondrial peroxiredoxin iii
PDB Compounds: (H:) Thioredoxin-dependent peroxide reductase

SCOPe Domain Sequences for d1zyeh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyeh1 c.47.1.10 (H:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]}
qhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasefhdvn
cevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpglalrgl
fiidpngvikhlsvndlpvgrsveetlrlvkafqfvea

SCOPe Domain Coordinates for d1zyeh1:

Click to download the PDB-style file with coordinates for d1zyeh1.
(The format of our PDB-style files is described here.)

Timeline for d1zyeh1: