![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
![]() | Protein Peroxiredoxin-3 (AOP-1, SP-22) [142391] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [142392] (1 PDB entry) |
![]() | Domain d1zyef1: 1zye F:6-163 [125822] automatically matched to 1ZYE A:6-163 mutant |
PDB Entry: 1zye (more details), 3.3 Å
SCOP Domain Sequences for d1zyef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zyef1 c.47.1.10 (F:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} qhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasefhdvn cevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpglalrgl fiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
Timeline for d1zyef1: