SCOP 1.73: Domain d1zyba2: 1zyb A:1-147

Lineage for d1zyba2 (1zyb A:1-147)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (10 proteins)
   Pfam PF00027

6. Protein Probable transcription regulator BT4300, N-terminal domain [141639] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [141640] (1 PDB entry)

8. Domain d1zyba2: 1zyb A:1-147 [125816]
   Other proteins in same PDB: d1zyba1
   complexed with gol

Details for d1zyba2

PDB Entry: 1zyb, 2.15 Å

PDB Description: crystal structure of transcription regulator from bacteroides thetaiotaomicron vpi-5482 at 2.15 a resolution

PDB Compounds: (A:) transcription regulator, CRP family

SCOP Domain Sequences for d1zyba2:

Sequence; same for both SEQRES and ATOM records:

>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
metmfdtllqlplfqglchedftsildkvklhfikhkagetiiksgnpctqlcfllkgei
sivtnakeniytvieqieapyliepqslfgmntnyassyvahtevhtvciskafvlsdlf
rydifrlnymnivsnraqnlysrlwde

Timeline for d1zyba2:

• d1zyba2 is new in SCOP 1.73
  
• d1zyba2 appears in SCOP 1.75
  
• d1zyba2 appears in the current release, SCOPe 2.08