Lineage for d1zyba2 (1zyb A:1-147)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816664Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2816777Protein Probable transcription regulator BT4300, N-terminal domain [141639] (1 species)
  7. 2816778Species Bacteroides thetaiotaomicron [TaxId:818] [141640] (1 PDB entry)
    Uniprot Q89ZS6 1-147
  8. 2816779Domain d1zyba2: 1zyb A:1-147 [125816]
    Other proteins in same PDB: d1zyba1, d1zyba3
    complexed with gol

Details for d1zyba2

PDB Entry: 1zyb (more details), 2.15 Å

PDB Description: crystal structure of transcription regulator from bacteroides thetaiotaomicron vpi-5482 at 2.15 a resolution
PDB Compounds: (A:) transcription regulator, CRP family

SCOPe Domain Sequences for d1zyba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
metmfdtllqlplfqglchedftsildkvklhfikhkagetiiksgnpctqlcfllkgei
sivtnakeniytvieqieapyliepqslfgmntnyassyvahtevhtvciskafvlsdlf
rydifrlnymnivsnraqnlysrlwde

SCOPe Domain Coordinates for d1zyba2:

Click to download the PDB-style file with coordinates for d1zyba2.
(The format of our PDB-style files is described here.)

Timeline for d1zyba2: