![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
![]() | Protein Probable transcription regulator BT4300, N-terminal domain [141639] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [141640] (1 PDB entry) Uniprot Q89ZS6 1-147 |
![]() | Domain d1zyba2: 1zyb A:1-147 [125816] Other proteins in same PDB: d1zyba1, d1zyba3 complexed with gol |
PDB Entry: 1zyb (more details), 2.15 Å
SCOPe Domain Sequences for d1zyba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} metmfdtllqlplfqglchedftsildkvklhfikhkagetiiksgnpctqlcfllkgei sivtnakeniytvieqieapyliepqslfgmntnyassyvahtevhtvciskafvlsdlf rydifrlnymnivsnraqnlysrlwde
Timeline for d1zyba2: