SCOPe 2.07: Domain d1zyba1: 1zyb A:148-220

Lineage for d1zyba1 (1zyb A:148-220)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Probable transcription regulator BT4300, C-terminal domain [140231] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [140232] (1 PDB entry)
   Uniprot Q89ZS6 148-220

8. Domain d1zyba1: 1zyb A:148-220 [125815]
   Other proteins in same PDB: d1zyba2, d1zyba3
   complexed with gol

Details for d1zyba1

PDB Entry: 1zyb, 2.15 Å

PDB Description: crystal structure of transcription regulator from bacteroides thetaiotaomicron vpi-5482 at 2.15 a resolution

PDB Compounds: (A:) transcription regulator, CRP family

SCOPe Domain Sequences for d1zyba1:

Sequence; same for both SEQRES and ATOM records:

>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
ptldlkskiirfflshcekpqgektfkvkmddlarclddtrlnisktlnelqdnglielh
rkeilipdaqkll

Timeline for d1zyba1:

• d1zyba1 first appeared in SCOP 1.73
  
• d1zyba1 appears in SCOPe 2.06
  
• d1zyba1 appears in the current release, SCOPe 2.08