Lineage for d1zyba1 (1zyb A:148-220)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982239Family a.4.5.4: CAP C-terminal domain-like [46796] (9 protein domains)
  6. 1982325Protein Probable transcription regulator BT4300, C-terminal domain [140231] (1 species)
  7. 1982326Species Bacteroides thetaiotaomicron [TaxId:818] [140232] (1 PDB entry)
    Uniprot Q89ZS6 148-220
  8. 1982327Domain d1zyba1: 1zyb A:148-220 [125815]
    Other proteins in same PDB: d1zyba2, d1zyba3
    complexed with gol

Details for d1zyba1

PDB Entry: 1zyb (more details), 2.15 Å

PDB Description: Crystal structure of transcription regulator from Bacteroides thetaiotaomicron VPI-5482 at 2.15 A resolution
PDB Compounds: (A:) transcription regulator, CRP family

SCOPe Domain Sequences for d1zyba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
ptldlkskiirfflshcekpqgektfkvkmddlarclddtrlnisktlnelqdnglielh
rkeilipdaqkll

SCOPe Domain Coordinates for d1zyba1:

Click to download the PDB-style file with coordinates for d1zyba1.
(The format of our PDB-style files is described here.)

Timeline for d1zyba1: