Lineage for d1zy9a2 (1zy9 A:178-525)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832243Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (6 proteins)
    Pfam PF01055
  6. 2832244Protein Alpha-galactosidase GalA catalytic domain [141794] (1 species)
    includes extra C-terminal all-beta subdomain, 4-stranded meander beta-sheet
  7. 2832245Species Thermotoga maritima [TaxId:2336] [141795] (1 PDB entry)
    Uniprot O33835 178-525
  8. 2832246Domain d1zy9a2: 1zy9 A:178-525 [125814]
    Other proteins in same PDB: d1zy9a1, d1zy9a3
    complexed with edo, gol

Details for d1zy9a2

PDB Entry: 1zy9 (more details), 2.34 Å

PDB Description: Crystal structure of Alpha-galactosidase (EC 3.2.1.22) (Melibiase) (tm1192) from Thermotoga maritima at 2.34 A resolution
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d1zy9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]}
rvpkhtptgwcswyhyfldltweetlknlklaknfpfevfqiddayekdigdwlvtrgdf
psveemakviaengfipgiwtapfsvsetsdvfnehpdwvvkengepkmayrnwnkkiya
ldlskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpiqafrkgietirk
avgedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwalrnaitryfm
hdrfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrdhgkkvlket
lellggrprvqnimsedlryeivssgtlsgnvkivvdlnsreyhleke

SCOPe Domain Coordinates for d1zy9a2:

Click to download the PDB-style file with coordinates for d1zy9a2.
(The format of our PDB-style files is described here.)

Timeline for d1zy9a2: