![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (5 proteins) Pfam PF16863 |
![]() | Protein Alpha-galactosidase GalA N-terminal domain [141175] (1 species) rudiment, partly refolded form of supersandwich fold |
![]() | Species Thermotoga maritima [TaxId:2336] [141176] (1 PDB entry) Uniprot O33835 1-177 |
![]() | Domain d1zy9a1: 1zy9 A:1-177 [125813] Other proteins in same PDB: d1zy9a2, d1zy9a3 complexed with edo, gol |
PDB Entry: 1zy9 (more details), 2.34 Å
SCOPe Domain Sequences for d1zy9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zy9a1 b.30.5.11 (A:1-177) Alpha-galactosidase GalA N-terminal domain {Thermotoga maritima [TaxId: 2336]} meifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlvn nwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflsski ahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgmenna
Timeline for d1zy9a1: