Lineage for d1zy9a1 (1zy9 A:1-177)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782059Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (5 proteins)
    Pfam PF16863
  6. 2782060Protein Alpha-galactosidase GalA N-terminal domain [141175] (1 species)
    rudiment, partly refolded form of supersandwich fold
  7. 2782061Species Thermotoga maritima [TaxId:2336] [141176] (1 PDB entry)
    Uniprot O33835 1-177
  8. 2782062Domain d1zy9a1: 1zy9 A:1-177 [125813]
    Other proteins in same PDB: d1zy9a2, d1zy9a3
    complexed with edo, gol

Details for d1zy9a1

PDB Entry: 1zy9 (more details), 2.34 Å

PDB Description: Crystal structure of Alpha-galactosidase (EC 3.2.1.22) (Melibiase) (tm1192) from Thermotoga maritima at 2.34 A resolution
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d1zy9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zy9a1 b.30.5.11 (A:1-177) Alpha-galactosidase GalA N-terminal domain {Thermotoga maritima [TaxId: 2336]}
meifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlvn
nwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflsski
ahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgmenna

SCOPe Domain Coordinates for d1zy9a1:

Click to download the PDB-style file with coordinates for d1zy9a1.
(The format of our PDB-style files is described here.)

Timeline for d1zy9a1: