Lineage for d1zy3a1 (1zy3 A:1-170)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021131Protein Apoptosis regulator Bcl-w [90103] (1 species)
  7. 3021132Species Human (Homo sapiens) [TaxId:9606] [90104] (3 PDB entries)
  8. 3021133Domain d1zy3a1: 1zy3 A:1-170 [125812]
    automatically matched to d1mk3a_

Details for d1zy3a1

PDB Entry: 1zy3 (more details)

PDB Description: structural model of complex of bcl-w protein with bid bh3-peptide
PDB Compounds: (A:) Apoptosis regulator Bcl-W

SCOPe Domain Sequences for d1zy3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zy3a1 f.1.4.1 (A:1-170) Apoptosis regulator Bcl-w {Human (Homo sapiens) [TaxId: 9606]}
atpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtf
sdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemevlvgq
vqewmvayletrladwihssggwaeftalygdgaleearrlregnwasvr

SCOPe Domain Coordinates for d1zy3a1:

Click to download the PDB-style file with coordinates for d1zy3a1.
(The format of our PDB-style files is described here.)

Timeline for d1zy3a1: