![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein Transcriptional activator sigm54 (NtrC1), N-terminal domain [102230] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [102231] (2 PDB entries) |
![]() | Domain d1zy2a1: 1zy2 A:1-136 [125811] Other proteins in same PDB: d1zy2a2 complexed with mg |
PDB Entry: 1zy2 (more details), 3.03 Å
SCOPe Domain Sequences for d1zy2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zy2a1 c.23.1.1 (A:1-136) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk lrkenellrrekdlke
Timeline for d1zy2a1: