SCOPe 2.08: Domain d1zy2a1: 1zy2 A:1-136

Lineage for d1zy2a1 (1zy2 A:1-136)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Transcriptional activator sigm54 (NtrC1), N-terminal domain [102230] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [102231] (2 PDB entries)

8. Domain d1zy2a1: 1zy2 A:1-136 [125811]
   Other proteins in same PDB: d1zy2a2
   complexed with mg

Details for d1zy2a1

PDB Entry: 1zy2, 3.03 Å

PDB Description: Crystal structure of the phosphorylated receiver domain of the transcription regulator NtrC1 from Aquifex aeolicus

PDB Compounds: (A:) transcriptional regulator NtrC1

SCOPe Domain Sequences for d1zy2a1:

Sequence; same for both SEQRES and ATOM records:

>d1zy2a1 c.23.1.1 (A:1-136) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
lrkenellrrekdlke

Timeline for d1zy2a1:

• d1zy2a1 first appeared in SCOP 1.73
  
• d1zy2a1 appears in SCOPe 2.07