SCOP 1.73: Domain d1zxyd2: 1zxy D:71-344

Lineage for d1zxyd2 (1zxy D:71-344)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (1 family)

5. Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (3 proteins)

6. Protein Anthranilate phosphoribosyltransferase (TrpD) [82364] (3 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82365] (5 PDB entries)

8. Domain d1zxyd2: 1zxy D:71-344 [125810]
   Other proteins in same PDB: d1zxya1, d1zxyb1, d1zxyc1, d1zxyd1
   automatically matched to d1gxbc2
   complexed with mg, prp

Details for d1zxyd2

PDB Entry: 1zxy, 2.56 Å

PDB Description: anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium

PDB Compounds: (D:) Anthranilate phosphoribosyltransferase

SCOP Domain Sequences for d1zxyd2:

Sequence; same for both SEQRES and ATOM records:

>d1zxyd2 c.27.1.1 (D:71-344) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
vpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsadvlealgynii
vpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpanakyqlm
gvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieevklnvtd
fgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgdfregye
yadhlieksldklneiismngdvtklktivvkss

Timeline for d1zxyd2:

• d1zxyd2 is new in SCOP 1.73
  
• d1zxyd2 appears in SCOP 1.75
  
• d1zxyd2 appears in the current release, SCOPe 2.08