SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1zxyd2 (1zxy D:71-344)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106674Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2106675Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2106676Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 protein domains)
  6. 2106677Protein Anthranilate phosphoribosyltransferase (TrpD) [82364] (3 species)
  7. 2106685Species Sulfolobus solfataricus [TaxId:2287] [82365] (7 PDB entries)
  8. 2106707Domain d1zxyd2: 1zxy D:71-344 [125810]
    Other proteins in same PDB: d1zxya1, d1zxyb1, d1zxyc1, d1zxyd1
    automated match to d1o17c2
    complexed with mg, prp

Details for d1zxyd2

PDB Entry: 1zxy (more details), 2.56 Å

PDB Description: Anthranilate Phosphoribosyltransferase from Sulfolobus solfataricus in complex with PRPP and Magnesium
PDB Compounds: (D:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1zxyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxyd2 c.27.1.1 (D:71-344) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]}
vpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsadvlealgynii
vpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpanakyqlm
gvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieevklnvtd
fgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgdfregye
yadhlieksldklneiismngdvtklktivvkss

SCOPe Domain Coordinates for d1zxyd2:

Click to download the PDB-style file with coordinates for d1zxyd2.
(The format of our PDB-style files is described here.)

Timeline for d1zxyd2: