Lineage for d1zxyc2 (1zxy C:71-344)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2469961Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2469962Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2469963Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)
  6. 2469964Protein Anthranilate phosphoribosyltransferase (TrpD) [82364] (3 species)
  7. 2469972Species Sulfolobus solfataricus [TaxId:2287] [82365] (7 PDB entries)
  8. 2469987Domain d1zxyc2: 1zxy C:71-344 [125808]
    Other proteins in same PDB: d1zxya1, d1zxyb1, d1zxyc1, d1zxyd1
    automated match to d1o17c2
    complexed with mg, prp

Details for d1zxyc2

PDB Entry: 1zxy (more details), 2.56 Å

PDB Description: anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium
PDB Compounds: (C:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1zxyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxyc2 c.27.1.1 (C:71-344) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]}
vpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsadvlealgynii
vpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpanakyqlm
gvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieevklnvtd
fgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgdfregye
yadhlieksldklneiismngdvtklktivvkss

SCOPe Domain Coordinates for d1zxyc2:

Click to download the PDB-style file with coordinates for d1zxyc2.
(The format of our PDB-style files is described here.)

Timeline for d1zxyc2: