SCOP 1.73: Domain d1zxyc1: 1zxy C:1-70

Lineage for d1zxyc1 (1zxy C:1-70)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family)

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81775] (5 PDB entries)

8. Domain d1zxyc1: 1zxy C:1-70 [125807]
   Other proteins in same PDB: d1zxya2, d1zxyb2, d1zxyc2, d1zxyd2
   automatically matched to d1gxba1
   complexed with mg, prp

Details for d1zxyc1

PDB Entry: 1zxy, 2.56 Å

PDB Description: anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium

PDB Compounds: (C:) Anthranilate phosphoribosyltransferase

SCOP Domain Sequences for d1zxyc1:

Sequence; same for both SEQRES and ATOM records:

>d1zxyc1 a.46.2.1 (C:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

Timeline for d1zxyc1:

• d1zxyc1 is new in SCOP 1.73
  
• d1zxyc1 appears in SCOP 1.75
  
• d1zxyc1 appears in the current release, SCOPe 2.08