Lineage for d1zxyc1 (1zxy C:1-70)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. Species Sulfolobus solfataricus [TaxId:2287] [81775] (7 PDB entries)
  8. Domain d1zxyc1: 1zxy C:1-70 [125807]
    Other proteins in same PDB: d1zxya2, d1zxyb2, d1zxyc2, d1zxyd2
    automated match to d1o17c1
    complexed with mg, prp

Details for d1zxyc1

PDB Entry: 1zxy (more details), 2.56 Å

PDB Description: anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium
PDB Compounds: (C:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1zxyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxyc1 a.46.2.1 (C:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

SCOPe Domain Coordinates for d1zxyc1 are not available.

Timeline for d1zxyc1:

Domains from same chain:
(mouse over for more information)
d1zxyc2
Domains from other chains:
(mouse over for more information)
d1zxya1, d1zxya2, d1zxyb1, d1zxyb2, d1zxyd1, d1zxyd2