Lineage for d1zxvb2 (1zxv B:551-776)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2571409Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
    automatically mapped to Pfam PF07737
  6. 2571410Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
    duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain
  7. 2571411Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries)
  8. 2571420Domain d1zxvb2: 1zxv B:551-776 [125801]
    Other proteins in same PDB: d1zxva3, d1zxvb3
    automated match to d1j7nb2
    complexed with mfm, zn

Details for d1zxvb2

PDB Entry: 1zxv (more details), 2.67 Å

PDB Description: X-Ray Crystal Structure of the Anthrax Lethal Factor Bound to a Small Molecule Inhibitor, BI-MFM3, 3-{5-[5-(4-Chloro-phenyl)-furan-2-ylmethylene]-4-oxo-2-thioxo-thiazolidin-3-yl}-propionic acid.
PDB Compounds: (B:) Lethal Factor

SCOPe Domain Sequences for d1zxvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxvb2 d.92.1.14 (B:551-776) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

SCOPe Domain Coordinates for d1zxvb2:

Click to download the PDB-style file with coordinates for d1zxvb2.
(The format of our PDB-style files is described here.)

Timeline for d1zxvb2: