SCOP 1.73: Domain d1zxvb1: 1zxv B:27-263

Lineage for d1zxvb1 (1zxv B:27-263)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Bacillus anthracis [TaxId:1392] [69777] (9 PDB entries)

8. Domain d1zxvb1: 1zxv B:27-263 [125800]
   Other proteins in same PDB: d1zxva3, d1zxvb3
   automatically matched to d1j7na1
   complexed with mfm, zn

Details for d1zxvb1

PDB Entry: 1zxv, 2.67 Å

PDB Description: X-Ray Crystal Structure of the Anthrax Lethal Factor Bound to a Small Molecule Inhibitor, BI-MFM3, 3-{5-[5-(4-Chloro-phenyl)-furan-2-ylmethylene]-4-oxo-2-thioxo-thiazolidin-3-yl}-propionic acid.

PDB Compounds: (B:) Lethal Factor

SCOP Domain Sequences for d1zxvb1:

Sequence; same for both SEQRES and ATOM records:

>d1zxvb1 d.92.1.14 (B:27-263) Anthrax toxin lethal factor, N- and C-terminal domains {Bacillus anthracis [TaxId: 1392]}
ernktqeehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdg
ditkhislealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekaln
vyyeigkilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefl
eqnsnevqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr

Timeline for d1zxvb1:

• d1zxvb1 is new in SCOP 1.73
  
• d1zxvb1 appears in SCOP 1.75
  
• d1zxvb1 appears in the current release, SCOPe 2.08