Lineage for d1zxva2 (1zxv A:551-776)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729579Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)
  6. 729580Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
    duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain
  7. 729581Species Bacillus anthracis [TaxId:1392] [69777] (9 PDB entries)
  8. 729588Domain d1zxva2: 1zxv A:551-776 [125798]
    Other proteins in same PDB: d1zxva3, d1zxvb3
    automatically matched to d1j7nb2
    complexed with mfm, zn

Details for d1zxva2

PDB Entry: 1zxv (more details), 2.67 Å

PDB Description: X-Ray Crystal Structure of the Anthrax Lethal Factor Bound to a Small Molecule Inhibitor, BI-MFM3, 3-{5-[5-(4-Chloro-phenyl)-furan-2-ylmethylene]-4-oxo-2-thioxo-thiazolidin-3-yl}-propionic acid.
PDB Compounds: (A:) Lethal Factor

SCOP Domain Sequences for d1zxva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxva2 d.92.1.14 (A:551-776) Anthrax toxin lethal factor, N- and C-terminal domains {Bacillus anthracis [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

SCOP Domain Coordinates for d1zxva2:

Click to download the PDB-style file with coordinates for d1zxva2.
(The format of our PDB-style files is described here.)

Timeline for d1zxva2: