Lineage for d1zxof1 (1zxo F:3-106)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701705Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (5 proteins)
  6. 701710Protein Hypothetical protein BT3618 [142456] (1 species)
  7. 701711Species Bacteroides thetaiotaomicron [TaxId:818] [142457] (1 PDB entry)
  8. 701722Domain d1zxof1: 1zxo F:3-106 [125794]
    automatically matched to 1ZXO A:3-106

Details for d1zxof1

PDB Entry: 1zxo (more details), 3.2 Å

PDB Description: X-ray Crystal Structure of Protein Q8A1P1 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR25.
PDB Compounds: (F:) conserved hypothetical protein Q8A1P1

SCOP Domain Sequences for d1zxof1:

Sequence, based on SEQRES records: (download)

>d1zxof1 c.55.1.5 (F:3-106) Hypothetical protein BT3618 {Bacteroides thetaiotaomicron [TaxId: 818]}
liadsgstktdwcvvlngavikrlgtkginpffqseeeiqqkltasllpqlpegkfnavy
fygagctpekapvlrraiadslpvignikansdmlaaahglcgq

Sequence, based on observed residues (ATOM records): (download)

>d1zxof1 c.55.1.5 (F:3-106) Hypothetical protein BT3618 {Bacteroides thetaiotaomicron [TaxId: 818]}
liadsgstktdwcvlngikrlgtkginpffqseeeiqqkltasllpqlpegkfnavyfyg
agctpekapvlrraiadslpvignikansdmlaaahglcgq

SCOP Domain Coordinates for d1zxof1:

Click to download the PDB-style file with coordinates for d1zxof1.
(The format of our PDB-style files is described here.)

Timeline for d1zxof1: