SCOPe 2.05: Domain d1zxod1: 1zxo D:3-106

Lineage for d1zxod1 (1zxo D:3-106)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (5 proteins)

6. Protein Hypothetical protein BT3618 [142456] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [142457] (1 PDB entry)
   Uniprot Q8A1P1 107-280! Uniprot Q8A1P1 3-106

8. Domain d1zxod1: 1zxo D:3-106 [125790]
   automatically matched to 1ZXO A:3-106

Details for d1zxod1

PDB Entry: 1zxo, 3.2 Å

PDB Description: X-ray Crystal Structure of Protein Q8A1P1 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR25.

PDB Compounds: (D:) conserved hypothetical protein Q8A1P1

SCOPe Domain Sequences for d1zxod1:

Sequence; same for both SEQRES and ATOM records:

>d1zxod1 c.55.1.5 (D:3-106) Hypothetical protein BT3618 {Bacteroides thetaiotaomicron [TaxId: 818]}
liadsgstktdwcvvlngavikrlgtkginpffqseeeiqqkltasllpqlpegkfnavy
fygagctpekapvlrraiadslpvignikansdmlaaahglcgq

Timeline for d1zxod1:

• d1zxod1 first appeared in SCOP 1.73
  
• d1zxod1 appears in SCOPe 2.04
  
• d1zxod1 appears in SCOPe 2.06
  
• d1zxod1 appears in the current release, SCOPe 2.08