Lineage for d1zxoa2 (1zxo A:107-280)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492306Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (5 proteins)
  6. 2492311Protein Hypothetical protein BT3618 [142456] (1 species)
  7. 2492312Species Bacteroides thetaiotaomicron [TaxId:818] [142457] (1 PDB entry)
    Uniprot Q8A1P1 107-280! Uniprot Q8A1P1 3-106
  8. 2492314Domain d1zxoa2: 1zxo A:107-280 [125785]

Details for d1zxoa2

PDB Entry: 1zxo (more details), 3.2 Å

PDB Description: X-ray Crystal Structure of Protein Q8A1P1 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR25.
PDB Compounds: (A:) conserved hypothetical protein Q8A1P1

SCOPe Domain Sequences for d1zxoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxoa2 c.55.1.5 (A:107-280) Hypothetical protein BT3618 {Bacteroides thetaiotaomicron [TaxId: 818]}
kagiacilgtgsnscfyngkeivsnisplgfilgdegsgavlgkllvgdilknqlpatlk
eeflkqfdltppeiidrvyrqpfpnrflaslspfiaqhleepairqlvmnsfiaffrrnv
mqydykqypvhfigsiaycykeilqdaarqtgiqigkilqspmegliqyhsqls

SCOPe Domain Coordinates for d1zxoa2:

Click to download the PDB-style file with coordinates for d1zxoa2.
(The format of our PDB-style files is described here.)

Timeline for d1zxoa2: