SCOP 1.73: Domain d1zxoa2: 1zxo A:107-280

Lineage for d1zxoa2 (1zxo A:107-280)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (5 proteins)

6. Protein Hypothetical protein BT3618 [142456] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [142457] (1 PDB entry)

8. Domain d1zxoa2: 1zxo A:107-280 [125785]

Details for d1zxoa2

PDB Entry: 1zxo, 3.2 Å

PDB Description: X-ray Crystal Structure of Protein Q8A1P1 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR25.

PDB Compounds: (A:) conserved hypothetical protein Q8A1P1

SCOP Domain Sequences for d1zxoa2:

Sequence; same for both SEQRES and ATOM records:

>d1zxoa2 c.55.1.5 (A:107-280) Hypothetical protein BT3618 {Bacteroides thetaiotaomicron [TaxId: 818]}
kagiacilgtgsnscfyngkeivsnisplgfilgdegsgavlgkllvgdilknqlpatlk
eeflkqfdltppeiidrvyrqpfpnrflaslspfiaqhleepairqlvmnsfiaffrrnv
mqydykqypvhfigsiaycykeilqdaarqtgiqigkilqspmegliqyhsqls

Timeline for d1zxoa2:

• d1zxoa2 is new in SCOP 1.73
  
• d1zxoa2 appears in SCOP 1.75
  
• d1zxoa2 appears in the current release, SCOPe 2.08