Lineage for d1zxif2 (1zxi F:1-177)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222156Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1222157Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1222227Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (5 proteins)
  6. 1222234Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 1222240Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [56189] (6 PDB entries)
  8. 1222252Domain d1zxif2: 1zxi F:1-177 [125781]
    Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib1, d1zxib2, d1zxic1, d1zxid1, d1zxid2, d1zxif1
    automatically matched to d1n5wc2
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxif2

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (F:) Carbon monoxide dehydrogenase medium chain

SCOPe Domain Sequences for d1zxif2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxif2 d.145.1.3 (F:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

SCOPe Domain Coordinates for d1zxif2:

Click to download the PDB-style file with coordinates for d1zxif2.
(The format of our PDB-style files is described here.)

Timeline for d1zxif2: