Lineage for d1zxif1 (1zxi F:178-286)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569462Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2569625Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2569685Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 2569686Protein automated matches [232090] (5 species)
    not a true protein
  7. Species Oligotropha carboxidovorans [TaxId:504832] [346370] (1 PDB entry)
  8. 2569714Domain d1zxif1: 1zxi F:178-286 [125780]
    Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib1, d1zxib2, d1zxic2, d1zxid1, d1zxid2, d1zxie1, d1zxie2, d1zxif2
    automated match to d1qj2c4
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxif1

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (F:) Carbon monoxide dehydrogenase medium chain

SCOPe Domain Sequences for d1zxif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxif1 d.87.2.0 (F:178-286) automated matches {Oligotropha carboxidovorans [TaxId: 504832]}
ghgyayeklkrkigdyataaaavvltmsggkcvsasigltnvantplwaeeagkvlvgta
ldkpaldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara

SCOPe Domain Coordinates for d1zxif1:

Click to download the PDB-style file with coordinates for d1zxif1.
(The format of our PDB-style files is described here.)

Timeline for d1zxif1: