Lineage for d1zxif1 (1zxi F:178-286)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422939Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1423096Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 1423097Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 1423104Protein Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain [55449] (2 species)
  7. 1423110Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [55450] (6 PDB entries)
  8. 1423122Domain d1zxif1: 1zxi F:178-286 [125780]
    Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib1, d1zxib2, d1zxic2, d1zxid1, d1zxid2, d1zxie1, d1zxie2, d1zxif2
    automatically matched to d1n5wc1
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxif1

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (F:) Carbon monoxide dehydrogenase medium chain

SCOPe Domain Sequences for d1zxif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxif1 d.87.2.1 (F:178-286) Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
ghgyayeklkrkigdyataaaavvltmsggkcvsasigltnvantplwaeeagkvlvgta
ldkpaldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara

SCOPe Domain Coordinates for d1zxif1:

Click to download the PDB-style file with coordinates for d1zxif1.
(The format of our PDB-style files is described here.)

Timeline for d1zxif1: