| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) ![]() contains 2Fe-2S cluster |
| Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins) |
| Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species) |
| Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [47749] (6 PDB entries) |
| Domain d1zxid1: 1zxi D:85-156 [125778] Other proteins in same PDB: d1zxia2, d1zxib1, d1zxib2, d1zxic1, d1zxic2, d1zxid2, d1zxif1, d1zxif2 automatically matched to d1ffua1 complexed with cu, cum, fad, fes, mcn, po4 |
PDB Entry: 1zxi (more details), 1.7 Å
SCOPe Domain Sequences for d1zxid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxid1 a.56.1.1 (D:85-156) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
gtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctgyqn
ivkaiqyaaaki
Timeline for d1zxid1: