Lineage for d1zxic1 (1zxi C:178-287)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204289Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2204452Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2204453Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 2204460Protein Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain [55449] (2 species)
  7. 2204466Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [55450] (6 PDB entries)
  8. 2204477Domain d1zxic1: 1zxi C:178-287 [125776]
    Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib1, d1zxib2, d1zxic2, d1zxid1, d1zxid2, d1zxie1, d1zxie2, d1zxif2
    automatically matched to d1n5wc1
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxic1

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (C:) Carbon monoxide dehydrogenase medium chain

SCOPe Domain Sequences for d1zxic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxic1 d.87.2.1 (C:178-287) Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
ghgyayeklkrkigdyataaaavvltmsggkcvsasigltnvantplwaeeagkvlvgta
ldkpaldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarak

SCOPe Domain Coordinates for d1zxic1:

Click to download the PDB-style file with coordinates for d1zxic1.
(The format of our PDB-style files is described here.)

Timeline for d1zxic1: