Lineage for d1zxib2 (1zxi B:147-809)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432242Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 1432243Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 1432244Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 1432263Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 1432269Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [56011] (6 PDB entries)
  8. 1432280Domain d1zxib2: 1zxi B:147-809 [125775]
    Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib1, d1zxic1, d1zxic2, d1zxid1, d1zxid2, d1zxie1, d1zxie2, d1zxif1, d1zxif2
    automatically matched to d1n5wb2
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxib2

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (B:) Carbon monoxide dehydrogenase large chain

SCOPe Domain Sequences for d1zxib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxib2 d.133.1.1 (B:147-809) Carbon monoxide (CO) dehydrogenase molybdoprotein {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
vdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtdatfakaevvskdm
ftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisglpehkihviapd
igggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardyhmttelaatkdg
kilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdgvytnkasggvay
rcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymaplgweydsgnypla
mkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagpskncdilgvsmf
dsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimieegntdtapyglg
tygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfrvkglpekfktmk
elawasynspppnlepgleavnyydppnmtypfgayfcimdididtgvaktrrfyalddc
gtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflptavetpkwetdy
tvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphdawrlwkvgeqlg
lhv

SCOPe Domain Coordinates for d1zxib2:

Click to download the PDB-style file with coordinates for d1zxib2.
(The format of our PDB-style files is described here.)

Timeline for d1zxib2: