| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) ![]() |
| Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins) |
| Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species) |
| Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [54673] (6 PDB entries) |
| Domain d1zxib1: 1zxi B:6-146 [125774] Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib2, d1zxic1, d1zxic2, d1zxid1, d1zxid2, d1zxif1, d1zxif2 automatically matched to d1n63b1 complexed with cu, cum, fad, fes, mcn, po4 |
PDB Entry: 1zxi (more details), 1.7 Å
SCOPe Domain Sequences for d1zxib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxib1 d.41.1.1 (B:6-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
tveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshaharik
sidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakd
ryvaadaielvevdyeplpvl
Timeline for d1zxib1: