Lineage for d1zxia2 (1zxi A:3-81)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717622Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 717731Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
  6. 717749Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)
  7. 717750Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (3 PDB entries)
  8. 717751Domain d1zxia2: 1zxi A:3-81 [125773]
    Other proteins in same PDB: d1zxia1, d1zxib1, d1zxib2, d1zxic1, d1zxic2, d1zxid1, d1zxif1, d1zxif2
    automatically matched to d1ffud2
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxia2

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (A:) Carbon monoxide dehydrogenase small chain

SCOP Domain Sequences for d1zxia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxia2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
tmfavqangasittiegma

SCOP Domain Coordinates for d1zxia2:

Click to download the PDB-style file with coordinates for d1zxia2.
(The format of our PDB-style files is described here.)

Timeline for d1zxia2: