Lineage for d1zxcb1 (1zxc B:219-473)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729326Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (1 protein)
  6. 729327Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)
  7. 729328Species Human (Homo sapiens) [TaxId:9606] [55527] (4 PDB entries)
  8. 729334Domain d1zxcb1: 1zxc B:219-473 [125770]
    automatically matched to d1bkca_
    complexed with ih6, zn; mutant

Details for d1zxcb1

PDB Entry: 1zxc (more details), 2.28 Å

PDB Description: Crystal structure of catalytic domain of TNF-alpha converting enzyme (TACE) with inhibitor
PDB Compounds: (B:) adam 17

SCOP Domain Sequences for d1zxcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxcb1 d.92.1.10 (B:219-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiq
ieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlf
tyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltke
adlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsi
yktieskaqecfqer

SCOP Domain Coordinates for d1zxcb1:

Click to download the PDB-style file with coordinates for d1zxcb1.
(The format of our PDB-style files is described here.)

Timeline for d1zxcb1: