Lineage for d1zxbb1 (1zxb B:97-425)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820147Protein Enoyl-ACP reductase [51791] (6 species)
  7. 820194Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [82296] (15 PDB entries)
    Uniprot Q9BJJ9 96-424 # fragment
  8. 820220Domain d1zxbb1: 1zxb B:97-425 [125768]
    automatically matched to 1VRW A:97-425
    complexed with nad, tn3

Details for d1zxbb1

PDB Entry: 1zxb (more details), 2.68 Å

PDB Description: synthesis, biological activity, and x-ray crystal structural analysis of diaryl ether inhibitors of malarial enoyl acp reductase. part 1:4'-substituted triclosan derivatives
PDB Compounds: (B:) enoyl-acyl carrier reductase

SCOP Domain Sequences for d1zxbb1:

Sequence, based on SEQRES records: (download)

>d1zxbb1 c.2.1.2 (B:97-425) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntnq
nknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkllstdigsvas
fllsresraitgqtiyvdnglnimflpdd

Sequence, based on observed residues (ATOM records): (download)

>d1zxbb1 c.2.1.2 (B:97-425) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkytfidyaieys
ekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd

SCOP Domain Coordinates for d1zxbb1:

Click to download the PDB-style file with coordinates for d1zxbb1.
(The format of our PDB-style files is described here.)

Timeline for d1zxbb1: