SCOPe 2.07: Domain d1zx8c2: 1zx8 C:1-123

Lineage for d1zx8c2 (1zx8 C:1-123)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.3: TM1367-like [141519] (2 proteins)
   Pfam PF04126; DUF369

6. Protein Hypothetical protein TM1367 [141520] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141521] (1 PDB entry)
   Uniprot Q9X187 1-124

8. Domain d1zx8c2: 1zx8 C:1-123 [125766]
   Other proteins in same PDB: d1zx8a2, d1zx8b3, d1zx8c3
   automated match to d1zx8a1
   complexed with 1pe, ni

Details for d1zx8c2

PDB Entry: 1zx8, 1.9 Å

PDB Description: crystal structure of an atypical cyclophilin (peptidylprolyl cis-trans isomerase) (tm1367) from thermotoga maritima at 1.90 a resolution

PDB Compounds: (C:) hypothetical protein TM1367

SCOPe Domain Sequences for d1zx8c2:

Sequence; same for both SEQRES and ATOM records:

>d1zx8c2 b.62.1.3 (C:1-123) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]}
mrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenprev
veigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekvavr
fas

Timeline for d1zx8c2:

• d1zx8c2 first appeared in SCOP 1.73, called d1zx8c1
  
• d1zx8c2 appears in SCOPe 2.06
  
• d1zx8c2 appears in the current release, SCOPe 2.08