![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.3: TM1367-like [141519] (2 proteins) Pfam PF04126; DUF369 |
![]() | Protein Hypothetical protein TM1367 [141520] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [141521] (1 PDB entry) Uniprot Q9X187 1-124 |
![]() | Domain d1zx8b_: 1zx8 B: [125765] automated match to d1zx8a1 complexed with 1pe, ni |
PDB Entry: 1zx8 (more details), 1.9 Å
SCOPe Domain Sequences for d1zx8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zx8b_ b.62.1.3 (B:) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]} hhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenp revveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekv avrfass
Timeline for d1zx8b_: