Lineage for d1zx8a1 (1zx8 A:1-124)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674704Family b.62.1.3: TM1367-like [141519] (1 protein)
    Pfam PF04126; DUF369
  6. 674705Protein Hypothetical protein TM1367 [141520] (1 species)
  7. 674706Species Thermotoga maritima [TaxId:2336] [141521] (1 PDB entry)
  8. 674707Domain d1zx8a1: 1zx8 A:1-124 [125764]
    complexed with 1pe, ni

Details for d1zx8a1

PDB Entry: 1zx8 (more details), 1.9 Å

PDB Description: crystal structure of an atypical cyclophilin (peptidylprolyl cis-trans isomerase) (tm1367) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (A:) hypothetical protein TM1367

SCOP Domain Sequences for d1zx8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zx8a1 b.62.1.3 (A:1-124) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]}
mrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenprev
veigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekvavr
fass

SCOP Domain Coordinates for d1zx8a1:

Click to download the PDB-style file with coordinates for d1zx8a1.
(The format of our PDB-style files is described here.)

Timeline for d1zx8a1: