SCOPe 2.08: Domain d1zx5a1: 1zx5 A:1-299

Lineage for d1zx5a1 (1zx5 A:1-299)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.3: Type I phosphomannose isomerase [51191] (4 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin

6. Protein Putative mannosephosphate isomerase AF0035 [141599] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [141600] (1 PDB entry)
   Uniprot O30200 1-299

8. Domain d1zx5a1: 1zx5 A:1-299 [125763]
   Other proteins in same PDB: d1zx5a2
   complexed with acy, edo, gol, lfr

Details for d1zx5a1

PDB Entry: 1zx5, 2.3 Å

PDB Description: the structure of a putative mannosephosphate isomerase from archaeoglobus fulgidus

PDB Compounds: (A:) mannosephosphate isomerase, putative

SCOPe Domain Sequences for d1zx5a1:

Sequence; same for both SEQRES and ATOM records:

>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeoglobus fulgidus [TaxId: 2234]}
melpsfifqaqenlverpwggewiallkgfrqsgigeswefsahtsrpstvlvkgqqlsm
ielfskhrdellgraaekfskfpilvrlidaasptqvhvhpsdkaaeslgeaeggvesaw
lvfnkgkayagfkedvkieeleeklkeedfdfktllntfettpydtfvirpgiphagegl
rvlevssnstlayffnendwekvkkvlntkkveefevkgkkgmaetenfglevvdvtgta
eiktggvmnilyaaegyfilrgketadlhrgysclvpastdsftvesergkivriylkv

Timeline for d1zx5a1:

• d1zx5a1 first appeared in SCOP 1.73
  
• d1zx5a1 appears in SCOPe 2.07