![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.3: Type I phosphomannose isomerase [51191] (4 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin |
![]() | Protein Putative mannosephosphate isomerase AF0035 [141599] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [141600] (1 PDB entry) Uniprot O30200 1-299 |
![]() | Domain d1zx5a1: 1zx5 A:1-299 [125763] Other proteins in same PDB: d1zx5a2 complexed with acy, edo, gol, lfr |
PDB Entry: 1zx5 (more details), 2.3 Å
SCOPe Domain Sequences for d1zx5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeoglobus fulgidus [TaxId: 2234]} melpsfifqaqenlverpwggewiallkgfrqsgigeswefsahtsrpstvlvkgqqlsm ielfskhrdellgraaekfskfpilvrlidaasptqvhvhpsdkaaeslgeaeggvesaw lvfnkgkayagfkedvkieeleeklkeedfdfktllntfettpydtfvirpgiphagegl rvlevssnstlayffnendwekvkkvlntkkveefevkgkkgmaetenfglevvdvtgta eiktggvmnilyaaegyfilrgketadlhrgysclvpastdsftvesergkivriylkv
Timeline for d1zx5a1: