SCOPe 2.05: Domain d1zx3a1: 1zx3 A:10-95

Lineage for d1zx3a1 (1zx3 A:10-95)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.6: NE0241-like [140544] (1 protein)
   contains extra C-terminal long helix; currently consists of an orphan protein

6. Protein Hypothetical protein NE0241 [140545] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [140546] (1 PDB entry)
   Uniprot Q82XL7 10-95

8. Domain d1zx3a1: 1zx3 A:10-95 [125762]

Details for d1zx3a1

PDB Entry: 1zx3, 2.5 Å

PDB Description: Structure of NE0241 Protein of Unknown Function from Nitrosomonas europaea

PDB Compounds: (A:) hypothetical protein NE0241

SCOPe Domain Sequences for d1zx3a1:

Sequence; same for both SEQRES and ATOM records:

>d1zx3a1 a.43.1.6 (A:10-95) Hypothetical protein NE0241 {Nitrosomonas europaea [TaxId: 915]}
evqqpdpmrknwimenmdsgviylleswlkaksqetgkeisdifanavefnivlkdwgke
kleetnteyqnqqrklrktyieyydr

Timeline for d1zx3a1:

• d1zx3a1 first appeared in SCOP 1.73
  
• d1zx3a1 appears in SCOPe 2.04
  
• d1zx3a1 appears in SCOPe 2.06
  
• d1zx3a1 appears in the current release, SCOPe 2.08