![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.6: NE0241-like [140544] (1 protein) contains extra C-terminal long helix; currently consists of an orphan protein |
![]() | Protein Hypothetical protein NE0241 [140545] (1 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [140546] (1 PDB entry) Uniprot Q82XL7 10-95 |
![]() | Domain d1zx3a1: 1zx3 A:10-95 [125762] |
PDB Entry: 1zx3 (more details), 2.5 Å
SCOPe Domain Sequences for d1zx3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zx3a1 a.43.1.6 (A:10-95) Hypothetical protein NE0241 {Nitrosomonas europaea [TaxId: 915]} evqqpdpmrknwimenmdsgviylleswlkaksqetgkeisdifanavefnivlkdwgke kleetnteyqnqqrklrktyieyydr
Timeline for d1zx3a1: