Lineage for d1zx3a1 (1zx3 A:10-95)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712739Family a.43.1.6: NE0241-like [140544] (1 protein)
    contains extra C-terminal long helix; currently consists of an orphan protein
  6. 2712740Protein Hypothetical protein NE0241 [140545] (1 species)
  7. 2712741Species Nitrosomonas europaea [TaxId:915] [140546] (1 PDB entry)
    Uniprot Q82XL7 10-95
  8. 2712742Domain d1zx3a1: 1zx3 A:10-95 [125762]

Details for d1zx3a1

PDB Entry: 1zx3 (more details), 2.5 Å

PDB Description: Structure of NE0241 Protein of Unknown Function from Nitrosomonas europaea
PDB Compounds: (A:) hypothetical protein NE0241

SCOPe Domain Sequences for d1zx3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zx3a1 a.43.1.6 (A:10-95) Hypothetical protein NE0241 {Nitrosomonas europaea [TaxId: 915]}
evqqpdpmrknwimenmdsgviylleswlkaksqetgkeisdifanavefnivlkdwgke
kleetnteyqnqqrklrktyieyydr

SCOPe Domain Coordinates for d1zx3a1:

Click to download the PDB-style file with coordinates for d1zx3a1.
(The format of our PDB-style files is described here.)

Timeline for d1zx3a1: