Lineage for d1zx1b1 (1zx1 B:2-230)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691939Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 692068Family c.23.5.3: Quinone reductase [52235] (3 proteins)
    binds FAD
  6. 692127Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 692128Species Human (Homo sapiens) [TaxId:9606] [52241] (6 PDB entries)
  8. 692136Domain d1zx1b1: 1zx1 B:2-230 [125761]
    automatically matched to d1qr2a_
    complexed with cb1, fad, zn

Details for d1zx1b1

PDB Entry: 1zx1 (more details), 2.16 Å

PDB Description: human quinone oxidoreductase 2 (nqo2) in complex with the cytostatic prodrug cb1954
PDB Compounds: (B:) nrh dehydrogenase [quinone] 2

SCOP Domain Sequences for d1zx1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zx1b1 c.23.5.3 (B:2-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
gkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtlsn
pevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlc
qgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgf
kvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOP Domain Coordinates for d1zx1b1:

Click to download the PDB-style file with coordinates for d1zx1b1.
(The format of our PDB-style files is described here.)

Timeline for d1zx1b1: