Lineage for d1zx1a_ (1zx1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856520Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2856618Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 2856619Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)
  8. 2856741Domain d1zx1a_: 1zx1 A: [125760]
    automated match to d1qr2a_
    complexed with cb1, fad, zn

Details for d1zx1a_

PDB Entry: 1zx1 (more details), 2.16 Å

PDB Description: human quinone oxidoreductase 2 (nqo2) in complex with the cytostatic prodrug cb1954
PDB Compounds: (A:) nrh dehydrogenase [quinone] 2

SCOPe Domain Sequences for d1zx1a_:

Sequence, based on SEQRES records: (download)

>d1zx1a_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhf

Sequence, based on observed residues (ATOM records): (download)

>d1zx1a_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgf
kvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhf

SCOPe Domain Coordinates for d1zx1a_:

Click to download the PDB-style file with coordinates for d1zx1a_.
(The format of our PDB-style files is described here.)

Timeline for d1zx1a_: