SCOPe 2.05: Domain d1zwyd_: 1zwy D:

Lineage for d1zwyd_ (1zwy D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (8 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [186916] (2 PDB entries)

8. Domain d1zwyd_: 1zwy D: [125756]
   Other proteins in same PDB: d1zwya1
   automated match to d1u14a_

Details for d1zwyd_

PDB Entry: 1zwy, 1.9 Å

PDB Description: crystal structure of protein vc0702 from vibrio cholerae

PDB Compounds: (D:) Hypothetical UPF0244 protein VC0702

SCOPe Domain Sequences for d1zwyd_:

Sequence; same for both SEQRES and ATOM records:

>d1zwyd_ c.51.4.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]}
mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr
nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakel
gdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyps

Timeline for d1zwyd_:

• d1zwyd_ first appeared in SCOP 1.73, called d1zwyd1
  
• d1zwyd_ appears in SCOPe 2.04
  
• d1zwyd_ appears in SCOPe 2.06
  
• d1zwyd_ appears in the current release, SCOPe 2.08