Lineage for d1zwyc_ (1zwy C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1604067Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 1604127Family c.51.4.0: automated matches [191335] (1 protein)
    not a true family
  6. 1604128Protein automated matches [190179] (7 species)
    not a true protein
  7. 1604165Species Vibrio cholerae [TaxId:666] [186916] (2 PDB entries)
  8. 1604167Domain d1zwyc_: 1zwy C: [125755]
    Other proteins in same PDB: d1zwya1
    automated match to d1u14a_

Details for d1zwyc_

PDB Entry: 1zwy (more details), 1.9 Å

PDB Description: crystal structure of protein vc0702 from vibrio cholerae
PDB Compounds: (C:) Hypothetical UPF0244 protein VC0702

SCOPe Domain Sequences for d1zwyc_:

Sequence, based on SEQRES records: (download)

>d1zwyc_ c.51.4.0 (C:) automated matches {Vibrio cholerae [TaxId: 666]}
vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv
rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqake
lgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehypsa

Sequence, based on observed residues (ATOM records): (download)

>d1zwyc_ c.51.4.0 (C:) automated matches {Vibrio cholerae [TaxId: 666]}
vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv
rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrelgd
vmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehypsa

SCOPe Domain Coordinates for d1zwyc_:

Click to download the PDB-style file with coordinates for d1zwyc_.
(The format of our PDB-style files is described here.)

Timeline for d1zwyc_: