Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (3 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.3: YjjX-like [110621] (2 proteins) Pfam PF01931 |
Protein Hypothetical protein VC0702 [142431] (1 species) |
Species Vibrio cholerae [TaxId:666] [142432] (2 PDB entries) |
Domain d1zwyc1: 1zwy C:9-181 [125755] automatically matched to 1ZWY A:9-181 |
PDB Entry: 1zwy (more details), 1.9 Å
SCOP Domain Sequences for d1zwyc1:
Sequence, based on SEQRES records: (download)
>d1zwyc1 c.51.4.3 (C:9-181) Hypothetical protein VC0702 {Vibrio cholerae [TaxId: 666]} vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqake lgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyp
>d1zwyc1 c.51.4.3 (C:9-181) Hypothetical protein VC0702 {Vibrio cholerae [TaxId: 666]} vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrelgd vmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyp
Timeline for d1zwyc1: