SCOPe 2.07: Domain d1zwya1: 1zwy A:9-181

Lineage for d1zwya1 (1zwy A:9-181)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.3: YjjX-like [110621] (2 proteins)
   Pfam PF01931

6. Protein Hypothetical protein VC0702 [142431] (1 species)

7. Species Vibrio cholerae [TaxId:666] [142432] (1 PDB entry)
   Uniprot Q9KU27 9-181

8. Domain d1zwya1: 1zwy A:9-181 [125753]
   Other proteins in same PDB: d1zwyb2, d1zwyb3, d1zwyc_, d1zwyd_

Details for d1zwya1

PDB Entry: 1zwy, 1.9 Å

PDB Description: crystal structure of protein vc0702 from vibrio cholerae

PDB Compounds: (A:) Hypothetical UPF0244 protein VC0702

SCOPe Domain Sequences for d1zwya1:

Sequence, based on SEQRES records:

>d1zwya1 c.51.4.3 (A:9-181) Hypothetical protein VC0702 {Vibrio cholerae [TaxId: 666]}
vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv
rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqake
lgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyp

Sequence, based on observed residues (ATOM records):

>d1zwya1 c.51.4.3 (A:9-181) Hypothetical protein VC0702 {Vibrio cholerae [TaxId: 666]}
vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv
rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqael
gdvmdevfgggaiglltrhhltrstvyhqalilalipfinpehyp

Timeline for d1zwya1:

• d1zwya1 first appeared in SCOP 1.73
  
• d1zwya1 appears in SCOPe 2.06
  
• d1zwya1 appears in the current release, SCOPe 2.08