Lineage for d1zwya1 (1zwy A:9-181)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700602Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 700764Superfamily c.51.4: ITPase-like [52972] (3 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 700804Family c.51.4.3: YjjX-like [110621] (2 proteins)
    Pfam PF01931
  6. 700805Protein Hypothetical protein VC0702 [142431] (1 species)
  7. 700806Species Vibrio cholerae [TaxId:666] [142432] (2 PDB entries)
  8. 700807Domain d1zwya1: 1zwy A:9-181 [125753]

Details for d1zwya1

PDB Entry: 1zwy (more details), 1.9 Å

PDB Description: crystal structure of protein vc0702 from vibrio cholerae
PDB Compounds: (A:) Hypothetical UPF0244 protein VC0702

SCOP Domain Sequences for d1zwya1:

Sequence, based on SEQRES records: (download)

>d1zwya1 c.51.4.3 (A:9-181) Hypothetical protein VC0702 {Vibrio cholerae [TaxId: 666]}
vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv
rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqake
lgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyp

Sequence, based on observed residues (ATOM records): (download)

>d1zwya1 c.51.4.3 (A:9-181) Hypothetical protein VC0702 {Vibrio cholerae [TaxId: 666]}
vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv
rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqael
gdvmdevfgggaiglltrhhltrstvyhqalilalipfinpehyp

SCOP Domain Coordinates for d1zwya1:

Click to download the PDB-style file with coordinates for d1zwya1.
(The format of our PDB-style files is described here.)

Timeline for d1zwya1: