Lineage for d1zwya1 (1zwy A:9-181)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120781Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2120998Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2121044Family c.51.4.3: YjjX-like [110621] (2 protein domains)
    Pfam PF01931
  6. 2121045Protein Hypothetical protein VC0702 [142431] (1 species)
  7. 2121046Species Vibrio cholerae [TaxId:666] [142432] (1 PDB entry)
    Uniprot Q9KU27 9-181
  8. 2121047Domain d1zwya1: 1zwy A:9-181 [125753]
    Other proteins in same PDB: d1zwyb2, d1zwyb3, d1zwyc_, d1zwyd_

Details for d1zwya1

PDB Entry: 1zwy (more details), 1.9 Å

PDB Description: Crystal structure of protein VC0702 from Vibrio cholerae
PDB Compounds: (A:) Hypothetical UPF0244 protein VC0702

SCOPe Domain Sequences for d1zwya1:

Sequence, based on SEQRES records: (download)

>d1zwya1 c.51.4.3 (A:9-181) Hypothetical protein VC0702 {Vibrio cholerae [TaxId: 666]}
vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv
rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqake
lgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyp

Sequence, based on observed residues (ATOM records): (download)

>d1zwya1 c.51.4.3 (A:9-181) Hypothetical protein VC0702 {Vibrio cholerae [TaxId: 666]}
vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv
rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqael
gdvmdevfgggaiglltrhhltrstvyhqalilalipfinpehyp

SCOPe Domain Coordinates for d1zwya1:

Click to download the PDB-style file with coordinates for d1zwya1.
(The format of our PDB-style files is described here.)

Timeline for d1zwya1: