Lineage for d1zwxa1 (1zwx A:41-333)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735706Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 735707Superfamily d.151.1: DNase I-like [56219] (3 families) (S)
  5. 735766Family d.151.1.3: Sphingomyelin phosphodiesterase-like [143902] (1 protein)
    part of Pfam PF03372
  6. 735767Protein Sphingomyelin phosphodiesterase C [143903] (2 species)
  7. 735779Species Listeria ivanovii [TaxId:1638] [143905] (1 PDB entry)
  8. 735780Domain d1zwxa1: 1zwx A:41-333 [125752]
    complexed with gol, po4

Details for d1zwxa1

PDB Entry: 1zwx (more details), 1.9 Å

PDB Description: Crystal Structure of SmcL
PDB Compounds: (A:) sphingomyelinase-c

SCOP Domain Sequences for d1zwxa1:

Sequence, based on SEQRES records: (download)

>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]}
ypgnfkitshnvylfsrniypnwgqmhradliaqadymknndvvilneafdtsashrlln
nlremyphqtpvigrskhgwdktegnysnfaledggvavvsqwpiveksqhifqrgggad
rlsnkgfayvkimkngkpyhiigthtqaddsliskdtsrairaeqmqeiqtfiakknipk
deiifiggdlnvnygtdeyhdmlkllnvsspanfngqmatwdpttnsmlkesypkaapey
ldyifvengharphswhnkvlhtkspqwsvkswfktytyqdfsdhypvvgftd

Sequence, based on observed residues (ATOM records): (download)

>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]}
ypgnfkitshnvylfsrniypnwgqmhradliaqadymknndvvilneafdtsashrlln
nlremyphqtpvigrskhgwdktegaledggvavvsqwpiveksqhifqrgggadrlsnk
gfayvkimkngkpyhiigthtqaddsliskdtsrairaeqmqeiqtfiakknipkdeiif
iggdlnvnygtdeyhdmlkllnvsspanfngqmatwdpttnsmlkesypkaapeyldyif
vengharphswhnkvlhtkspqwsvkswfktytyqdfsdhypvvgftd

SCOP Domain Coordinates for d1zwxa1:

Click to download the PDB-style file with coordinates for d1zwxa1.
(The format of our PDB-style files is described here.)

Timeline for d1zwxa1: